PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g07110.1.p
Common NameBRADI_4g07110, LOC100830760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 983aa    MW: 110138 Da    PI: 4.8588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g07110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-14853248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Bradi4g07110.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                      78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Bradi4g07110.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                       68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001675.15E-121053No hitNo description
PfamPF139214.6E-131070No hitNo description
SuperFamilySSF466896.47E-2133108IPR009057Homeodomain-like
CDDcd116591.13E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.2E-59406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 983 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDNRHK KRKRKGIDYN AEIPFEKRPP PGFYDTVGED RPLEHVQFPT  240
TIEELEGKRR VDVEAQLRKQ DIARNKILQR QDAPAAIMQA NKLNDPEAVT RRSKLMLPPP  300
QISDHELEEI AKMGNAGDPA LAEELGEGST ATRTLLASYS QTPRLGMTPL RTPQRTPGGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPELH PSDFSGVTPR KKEIQTPNPM ATPLASPGPG  420
VTPRIGMTPS RDGTSFGLTP KGTPFRDELR INEEVEMQDS AQLELRRQAE LRRGLRSGFA  480
SVPQPKNEYQ LVMPSITEEK EEVEEKIEED MSDRLARERA EEQARQEALL RKRSKVLQRS  540
LPRPPAASVE ILRQSLIKGG ESRSTFVPPT SLEQANELIS EELLRLLEHD NAKYPLDEQT  600
QKEKKKGSKR QANGAAFVPE IEGFDEHELK EASSMVEDEI QFLRVAMGHE NESFEDFVKS  660
HDACQEDLMF FPSNNSYGLA SVAGNADKIS ALQNEFEIVK KRMDDEAKKA SRLEQKIKLL  720
TQGYQVRAAK LGSQVQDTFK QMDTAATELE CFQELQKQEQ MAGAYRVRNL AEEVNNQKAL  780
ERTLQSRYGD LLSGYQKIQE QLEEHRRQLK LQEEAIEAEN RAREEEAAAQ NRVAEEEKER  840
KNHSVEEESG QMTSATNEEA TESKEVNGDQ MDMDKADGEL VGPIPPAPDA QVDNDEASVQ  900
QSTSNAESDG NAATNDGAGD KIDSSNLEGK EDKTAGGMDI DAGSQEEGKN AGATAVTSID  960
VETAAVSSDQ AVSNEENDTV PE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDNRHKKRKRK
2199204KKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576174.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLI1IIB30.0I1IIB3_BRADI; Uncharacterized protein
STRINGBRADI4G07110.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Representative plantOGRP39481723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5